PDB entry 4fyw

View 4fyw on RCSB PDB site
Description: E. coli Aspartate Transcarbamoylase complexed with CTP
Class: transferase
Keywords: pyrimidine nucleotide biosynthesis, feedback inhibition, allostery, TRANSFERASE
Deposited on 2012-07-05, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fywa1, d4fywa2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fywb1, d4fywb2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fywc1, d4fywc2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fywd1, d4fywd2
  • Heterogens: ZN, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fywA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fywB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fywB (B:)
    eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
    qvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrk
    randialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fywC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fywD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fywD (D:)
    eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
    qvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrk
    randialkckycekefshnvvlan