PDB entry 4fyt

View 4fyt on RCSB PDB site
Description: Human aminopeptidase N (CD13) in complex with amastatin
Class: hydrolase/hydrolase inhibitor
Keywords: metalloprotease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-05, released 2012-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15144 (1-902)
      • expression tag (0)
    Domains in SCOPe 2.05: d4fyta1, d4fyta2, d4fyta3, d4fyta4
  • Chain 'B':
    Compound: amastatin
    Database cross-references and differences (RAF-indexed):
    • PDB 4FYT (0-3)
  • Heterogens: NAG, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fytA (A:)
    pdqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihs
    kklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefeg
    eladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlt
    alsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwa
    rpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyre
    nsllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgady
    aeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvl
    rmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwt
    lqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlid
    vraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiind
    afnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkk
    qvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpn
    nnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnry
    lsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqa
    vtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwfte
    nsk
    

  • Chain 'B':
    No sequence available.