PDB entry 4fyq

View 4fyq on RCSB PDB site
Description: Human aminopeptidase N (CD13)
Class: hydrolase
Keywords: metalloprotease, HYDROLASE
Deposited on 2012-07-05, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fyqa1, d4fyqa2, d4fyqa3, d4fyqa4
  • Heterogens: NAG, BMA, ZN, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fyqA (A:)
    pdqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihs
    kklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefeg
    eladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlt
    alsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwa
    rpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyre
    nsllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgady
    aeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvl
    rmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwt
    lqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlid
    vraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiind
    afnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkk
    qvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpn
    nnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnry
    lsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqa
    vtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwfte
    nsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fyqA (A:)
    skawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskkl
    nytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegela
    ddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltals
    nmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwarps
    aiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensl
    lfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgadyaep
    twnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvlrml
    ssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwtlqm
    gfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvra
    qndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiindafn
    lasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkkqvt
    plfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpnnnp
    ihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnrylsy
    tlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndsnliqavtrrfsteyel
    qqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwftensk