PDB entry 4fyo

View 4fyo on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase complexed with N-{(S)-1-[7-(3,4-Dimethoxy-phenylamino)-thiazolo[5,4-d]pyrimidin-5-yl]-pyrrolidin-3-yl}-terephthalamic acid
Class: transferase/transferase inhibitor
Keywords: kinase inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-07-05, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.22
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d4fyoa1, d4fyoa2
  • Heterogens: 0VF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fyoA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fyoA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqld
    npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
    nfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfssk
    sdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtyd
    venrpgfaavelrlrnyyydvvneghh