PDB entry 4fxr

View 4fxr on RCSB PDB site
Description: Crystal structure of the mutant T159V.R203A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
Class: lyase/lyase inhibitor
Keywords: tim barrel, inhibitor BMP, LYASE-LYASE INHIBITOR complex
Deposited on 2012-07-03, released 2013-05-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.228
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-227)
      • conflict (100)
      • engineered mutation (158)
      • engineered mutation (202)
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-227)
      • conflict (100)
      • engineered mutation (158)
      • engineered mutation (202)
    Domains in SCOPe 2.02: d4fxrb_
  • Heterogens: BMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fxrB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxrB (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpsvrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgasiyladnpaaaaagiiesikdllnp