PDB entry 4fxl

View 4fxl on RCSB PDB site
Description: Crystal structure of the D76N Beta-2 Microglobulin mutant
Class: immune system
Keywords: immunoglobin, beta-sandwitch, amyloidosis, pathologic mutation, genetic disease, MHC class I, IMMUNE SYSTEM
Deposited on 2012-07-03, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.133
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered mutation (76)
    Domains in SCOPe 2.07: d4fxla_
  • Heterogens: NA, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fxlA (A:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekneyacrvnhvtlsqpkivkwdrdm