PDB entry 4fxb

View 4fxb on RCSB PDB site
Description: Crystal structure of CYP105N1 from Streptomyces coelicolor: a cytochrome P450 oxidase in the coelibactin siderophore biosynthetic pathway
Class: oxidoreductase
Keywords: P450, CYP105N1, Streptomyces coelicolor, coelibactin, estradiol, OXIDOREDUCTASE
Deposited on 2012-07-03, released 2012-11-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.282
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4fxba_
  • Chain 'B':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO7686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4fxbb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fxbA (A:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxbA (A:)
    prdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsadi
    rrpgfpgeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvdeildgm
    laaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvsealggl
    fgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagretttsmials
    tlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvpaddgv
    iallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevaletllrrv
    ptlrlagerdqvvvkhdsatfgleelmvtw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fxbB (B:)
    mtppesptashtpgatpprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtr
    yddvrellsdprvsadirrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftv
    rrvramrpavqarvdeildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdv
    trisgsrnstaeqvsealgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqll
    stlgitinagretttsmialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsip
    lrvaaedielsgrtvpaddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqc
    vgqhlarlelevaletllrrvptlrlagerdqvvvkhdsatfgleelmvtwhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxbB (B:)
    prdfpifaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsadirrpgf
    rpfirtdapehtryrrmllpaftvrrvramrpavqarvdeildgmlaaggpvdlvsayan
    avstsvicellgiprhdleffrdvtrisgsraeqvsealgglfgllgglvaerreeprdd
    lisklvtdhlvpgnvtteqllstlgitinagretttsmialstlllldrpelpaelrkdp
    dlmpaavdellrvlsvadsiplrvaaedielsgrtvpaddgviallaganhdpeqfddpe
    rvdfhrtdnhhvafgygvhqcvgqhlarlelevaletllrrvptlrlaerdqvvvkhdsa
    tfgleelmvt