PDB entry 4fx6

View 4fx6 on RCSB PDB site
Description: Crystal structure of the mutant V182A.R203A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
Class: lyase/lyase inhibitor
Keywords: tim barrel, inhibitor BMP, LYASE-LYASE INHIBITOR complex
Deposited on 2012-07-02, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.147
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (181)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d4fx6m_
  • Chain 'N':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-227)
      • conflict (100)
      • engineered mutation (181)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d4fx6n_
  • Heterogens: BMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fx6M (M:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fx6M (M:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqggd
    pgetlrfadaiivgasiyladnpaaaaagiiesikdll
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fx6N (N:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gagaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fx6N (N:)
    srrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkr
    fgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfl
    ltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispga
    gaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp