PDB entry 4fx2

View 4fx2 on RCSB PDB site
Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Deposited on 1991-10-17, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d4fx2__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fx2_ (-)
  akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
  ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
  dglridgdpraarddivgwahdvrgai