PDB entry 4fwy

View 4fwy on RCSB PDB site
Description: F33Y CuB myoglobin (F33Y L29H F43H sperm whale myoglobin) with copper bound
Class: transport protein
Keywords: Globin, Oxidase, TRANSPORT PROTEIN
Deposited on 2012-07-02, released 2012-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (32)
      • engineered mutation (42)
    Domains in SCOPe 2.08: d4fwya_
  • Heterogens: HEM, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fwyA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlykshpetlekhdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg