PDB entry 4fw2

View 4fw2 on RCSB PDB site
Description: Crystal structure of RSV three-domain integrase with disordered N-terminal domain
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2012-06-29, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • engineered mutation (165)
      • engineered mutation (198)
    Domains in SCOPe 2.04: d4fw2a1, d4fw2a2
  • Chain 'B':
    Compound: integrase
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • engineered mutation (165)
      • engineered mutation (198)
    Domains in SCOPe 2.04: d4fw2b1, d4fw2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fw2A (A:)
    plreakdlhtalhigpralskasnismqqarevvqtcphcnsapaleagvnprglgplqi
    wqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlgrpkaikt
    dngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdgfmkri
    ptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgewekgwnvl
    vwgrgyaavknrdtdkviwvpsrkvkpdit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fw2A (A:)
    prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav
    lgrpkaiktdngscftskstrewlarwgiahttgamveranrllkdkirvlaegdgfmkr
    iptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgewekgwnv
    lvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fw2B (B:)
    plreakdlhtalhigpralskasnismqqarevvqtcphcnsapaleagvnprglgplqi
    wqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlgrpkaikt
    dngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdgfmkri
    ptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgewekgwnvl
    vwgrgyaavknrdtdkviwvpsrkvkpdit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fw2B (B:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgiamveranrllkdkirvlaegdgfmkri
    ptskqgellakamyalnhkergenktpiqkhwrptvltegppvkirietgewekgwnvlv
    wgrgyaavknrdtdkviwvpsrkvkpd