PDB entry 4fw1

View 4fw1 on RCSB PDB site
Description: Crystal structure of two-domain RSV INTEGRASE covalently linked with DNA
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2012-06-29, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • engineered mutation (75-76)
      • engineered mutation (108)
      • engineered mutation (117)
      • engineered mutation (150)
    Domains in SCOPe 2.04: d4fw1a1, d4fw1a2
  • Chain 'B':
    Compound: integrase
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • engineered mutation (75-76)
      • engineered mutation (108)
      • engineered mutation (117)
      • engineered mutation (150)
    Domains in SCOPe 2.04: d4fw1b1, d4fw1b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fw1A (A:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fw1A (A:)
    prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav
    lgrpkaiktdngdaftskstrewlarwgiahttgamvcranrllkdkirvlaegdgfmkr
    iptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgewekgwnv
    lvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fw1B (B:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fw1B (B:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgew
    ekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi