PDB entry 4fvv

View 4fvv on RCSB PDB site
Description: Crystal structure of HCR/D-Sa-GBL1/C
Class: toxin
Keywords: botulinum toxin, ganglioside bing loop, Ganglioside, TOXIN
Deposited on 2012-06-29, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LBR1
      • see remark 999 (384)
      • see remark 999 (387)
      • see remark 999 (390-391)
    Domains in SCOPe 2.06: d4fvva1, d4fvva2
  • Chain 'B':
    Compound: Neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LBR1
      • see remark 999 (384)
      • see remark 999 (387)
      • see remark 999 (390-391)
    Domains in SCOPe 2.06: d4fvvb1, d4fvvb2
  • Heterogens: SO4, GOL, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fvvA (A:)
    nsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtq
    nenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    nseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskt
    itfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvkdywgnd
    lrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrge
    nvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyya
    sqlflssnattnrlgilsigsysfrlggdwyrheylipvikiehyaslleststhwvfvp
    ase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fvvA (A:)
    sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
    enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
    seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkltginfsktit
    fqmnkipsdninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydkeyymi
    nvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyfnttid
    nkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlflssnat
    tnrlgilsigsysfrlggdwyrheylipvikiehyaslleststhwvfvpas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fvvB (B:)
    nsindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtq
    nenivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    nseqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskt
    itfqmnkipntglitsdsdninmwirdfyifakelddkdinilfnslqytnvvkdywgnd
    lrydkeyyminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrge
    nvlyfnttidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyya
    sqlflssnattnrlgilsigsysfrlggdwyrheylipvikiehyaslleststhwvfvp
    ase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fvvB (B:)
    sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
    enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
    seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkltginfsktit
    fqmnkipntgsdninmwirdfyifakelddkdinilfnslqytnvvkdywgndlrydkey
    yminvnymnrymskkgngivfntrknnndfnegykiiikrirgntndtrvrgenvlyfnt
    tidnkqyslgmykpsrnlgtdlvplgaldqpmdeirkygsfiiqpcntfdyyasqlflss
    nattnrlgilsigsysfrlggdwyrheylipvikiehyaslleststhwvfvpas