PDB entry 4fvk

View 4fvk on RCSB PDB site
Description: Structural and functional characterization of neuraminidase-like molecule N10 derived from bat influenza A virus
Class: hydrolase
Keywords: 6-bladed beta-propeller, Calcium binding, Glycosylation, Membrane, HYDROLASE
Deposited on 2012-06-29, released 2012-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129345]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fvka_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:1129345]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fvkb_
  • Heterogens: CA, ZN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fvkA (A:)
    gspsrspeffywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkff
    iayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvan
    grdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriy
    elqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqive
    pcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqip
    ngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqels
    tfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fvkA (A:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fvkB (B:)
    gspsrspeffywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkff
    iayglsanqhllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvan
    grdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriy
    elqngtvqrwkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqive
    pcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqip
    ngiesegtvslsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqels
    tfcginspvqninwds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fvkB (B:)
    fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
    hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
    ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
    wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
    prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
    slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
    qninwds