PDB entry 4fvb

View 4fvb on RCSB PDB site
Description: Crystal structure of EV71 2A proteinase C110A mutant
Class: hydrolase
Keywords: hydrolase, cysteine proteinase
Deposited on 2012-06-29, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2A proteinase
    Species: Human enterovirus 71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9XG43
      • engineered mutation (111)
    Domains in SCOPe 2.07: d4fvba_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fvbA (A:)
    gsgkfgqqsgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcnc
    qtgvyycnsrrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcqh
    gvvgivstggnglvgfadvrdllwldeeameq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fvbA (A:)
    sgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqtgvyycn
    srrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcqhgvvgivst
    ggnglvgfadvrdllwld