PDB entry 4fv7

View 4fv7 on RCSB PDB site
Description: Crystal Structure of the ERK2 complexed with E94
Class: transferase
Keywords: transferase
Deposited on 2012-06-29, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERK2, MAPK1, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fv7a_
  • Heterogens: E94, SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fv7A (A:)
    maaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfe
    hqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqh
    lsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdh
    tgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhi
    lgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphk
    rieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fv7A (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
    rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
    dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
    pyleqyydpsdepiaeapfkfddlpkeklkelifeetarfqpgy