PDB entry 4fur

View 4fur on RCSB PDB site
Description: Crystal Structure of Urease subunit gamma 2 from Brucella melitensis biovar Abortus 2308
Class: hydrolase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Urease, Hydrolase
Deposited on 2012-06-28, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.153
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fura_
  • Chain 'B':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4furb_
  • Chain 'C':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4furc_
  • Chain 'D':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4furd_
  • Chain 'E':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fure_
  • Chain 'F':
    Compound: Urease subunit gamma 2
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: ureA2, BAB1_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4furf_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4furA (A:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furA (A:)
    mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
    rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4furB (B:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furB (B:)
    ltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdgars
    vlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4furC (C:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furC (C:)
    mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
    rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4furD (D:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furD (D:)
    mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
    rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4furE (E:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furE (E:)
    mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
    rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4furF (F:)
    gpgsmhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveev
    mdgarsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
    

    Sequence, based on observed residues (ATOM records): (download)
    >4furF (F:)
    mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
    rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit