PDB entry 4fu6

View 4fu6 on RCSB PDB site
Description: Crystal structure of the PSIP1 PWWP domain
Class: transcription
Keywords: Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2012-06-28, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PC4 and SFRS1-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PSIP1, DFS70, LEDGF, PSIP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (18-End)
      • expression tag (12-17)
    Domains in SCOPe 2.04: d4fu6a_
  • Heterogens: SO4, GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4fu6A (A:)
mhhhhhhssgrenlyfqgmtrdfkpgdlifakmkgyphwparvdevpdgavkpptnklpi
fffgthetaflgpkdifpysenkekygkpnkrkgfneglweidnnpkvkfssqqaatkqs
nassdveveeketsvskedtdheekasnedvtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4fu6A (A:)
nlyfqgmtrdfkpgdlifakmkgyphwparvdevpdvkpptnklpifffgthetaflgpk
difpysenkekygkpnkrkgfneglweidnnpkvk