PDB entry 4fsr

View 4fsr on RCSB PDB site
Description: Crystal Structure of the CHK1
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: TRANSFERASE, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2012-06-27, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fsra_
  • Heterogens: HKC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fsrA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgakrprvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fsrA (A:)
    vpfvedwdlvqtlgeggevqlavnrvteeavavkivdmknikkeicinkmlnhenvvkfy
    ghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdi
    kpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdv
    wscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenps
    aritipdikkdrwynkplkkgakrprvts