PDB entry 4fsh

View 4fsh on RCSB PDB site
Description: Crystal Structure of Shikimate Dehydrogenase (aroE) Clinical Variant v2356 from Helicobacter pylori in Complex with Shikimate
Class: oxidoreductase
Keywords: dehydrogenase, NADP Binding, OXIDOREDUCTASE
Deposited on 2012-06-27, released 2013-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.217
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56119 (0-262)
      • conflict (31)
      • conflict (33)
      • conflict (39)
      • conflict (51)
      • conflict (86-88)
      • conflict (114-115)
      • conflict (125)
      • conflict (135)
      • conflict (142)
      • conflict (150)
      • conflict (184)
      • conflict (201)
      • conflict (217)
      • conflict (224)
      • conflict (238)
    Domains in SCOPe 2.06: d4fsha1, d4fsha2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: Helicobacter pylori [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56119 (0-262)
      • conflict (31)
      • conflict (33)
      • conflict (39)
      • conflict (51)
      • conflict (86-88)
      • conflict (114-115)
      • conflict (125)
      • conflict (135)
      • conflict (142)
      • conflict (150)
      • conflict (184)
      • conflict (201)
      • conflict (217)
      • conflict (224)
      • conflict (238)
    Domains in SCOPe 2.06: d4fshb1, d4fshb2
  • Heterogens: SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fshA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkklgflghyrpillpleshikneflhlgls
    ganvtlpfkerafqvcdkikgialecasintlvlendelvgyntdalgfylslkhqnyqn
    alilgsggsakalacglkkqglkvsvlnrsprgldffqrlgcdcfmeppksafdliinat
    saslnnelplnkevlkgyfkeaklaydlaygfltpflalakelkipfqdgkdmliyqasl
    sfekfsasqipyskafevmrsvflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fshA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkklgflghyrpillpleshikneflhlgls
    ganvtlpfkerafqvcdkikgialecasintlvlendelvgyntdalgfylslkhqnyqn
    alilgsggsakalacglkkqglkvsvlnrsprgldffqrlgcdcfmeppksafdliinat
    saslnplnkevlkgyfkeaklaydlaygfltpflalakelkipfqdgkdmliyqaslsfe
    kfsasqipyskafevmrsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fshB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkklgflghyrpillpleshikneflhlgls
    ganvtlpfkerafqvcdkikgialecasintlvlendelvgyntdalgfylslkhqnyqn
    alilgsggsakalacglkkqglkvsvlnrsprgldffqrlgcdcfmeppksafdliinat
    saslnnelplnkevlkgyfkeaklaydlaygfltpflalakelkipfqdgkdmliyqasl
    sfekfsasqipyskafevmrsvflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fshB (B:)
    mklksfgvfgnpikhsksplihnacfltfqkklgflghyrpillpleshikneflhlgls
    ganvtlpfkerafqvcdkikgialecasintlvlendelvgyntdalgfylslkhqnyqn
    alilgsggsakalacglkkqglkvsvlnrsprgldffqrlgcdcfmeppksafdliinat
    saslnnelplnkevlkgyfkeaklaydlaygfltpflalakelkipfqdgkdmliyqasl
    sfekfsasqipyskafevmrsvf