PDB entry 4fs3

View 4fs3 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus enoyl-ACP reductase in complex with NADP and AFN-1252
Class: oxidoreductase
Keywords: Rossmann Fold, short chain dehydrogenase, NADPH binding, OXIDOREDUCTASE
Deposited on 2012-06-26, released 2012-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI
    Species: Staphylococcus aureus subsp. aureus [TaxId:282458]
    Gene: fabI, SAR0978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GI75 (0-255)
      • cloning artifact (211)
    Domains in SCOPe 2.03: d4fs3a_
  • Heterogens: 0WD, 0WE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fs3A (A:)
    mlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpea
    hlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdi
    ssysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgp
    dnirvnaisagpirtlsakgvggfntilkeikeraplkrnvdqvevgktaayllsdlssg
    vtgenihvdsgfhaik