PDB entry 4fqt

View 4fqt on RCSB PDB site
Description: Structure of AgamOBP1 Bound to 6-methyl-5-hepten-2-one
Class: Odorant-Binding Protein
Keywords: Odorant Binding Protein, Odorant-Binding Protein
Deposited on 2012-06-25, released 2013-01-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anopheles Gambiae Odorant Binding protein 1
    Species: Anopheles gambiae [TaxId:180454]
    Gene: AgamOBP1, AgaP_AGAP003309, agCG48275, OBP17, OBPjj83b AgaP_AGAP010409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fqta_
  • Chain 'B':
    Compound: Anopheles Gambiae Odorant Binding protein 1
    Species: Anopheles gambiae [TaxId:180454]
    Gene: AgamOBP1, AgaP_AGAP003309, agCG48275, OBP17, OBPjj83b AgaP_AGAP010409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fqtb_
  • Heterogens: 0VT, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fqtA (A:)
    dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
    eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
    hyflv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fqtB (B:)
    dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
    eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
    hyflv