PDB entry 4fqo

View 4fqo on RCSB PDB site
Description: Crystal Structure of Calcium-Loaded S100B Bound to SBi4211
Class: protein binding/inhibitor
Keywords: protein-inhibitor complex, EF-hand protein, Calcium binding protein, protein binding-inhibitor complex
Deposited on 2012-06-25, released 2012-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4fqoa_
  • Heterogens: CA, AZ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fqoA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsdgdgecdfqefmafvamittacheff