PDB entry 4fql

View 4fql on RCSB PDB site
Description: Influenza B HA Antibody (Fab) CR8033
Class: immune system
Keywords: Fab fragment, monoclonal, viral, immunoglobulin, Influenza B virus, IMMUNE SYSTEM
Deposited on 2012-06-25, released 2012-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: monoclonal antibody CR8033 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FQL (0-End)
• Chain 'L':
  Compound: monoclonal antibody CR8033 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FQL (0-214)
  Domains in SCOPe 2.06: d4fqll1, d4fqll2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fqlL (L:)
  eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygastratgip
  arfsgsgsgtdftltisrlepedlavyycqqygsspwtfgqgtkveikrtvaapsvfifp
  psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
  tlskadyekhkvyacevthqglsspvtksfnrgec