PDB entry 4fql

View 4fql on RCSB PDB site
Description: Influenza B HA Antibody (Fab) CR8033
Class: immune system
Keywords: Fab fragment, monoclonal, viral, immunoglobulin, Influenza B virus, IMMUNE SYSTEM
Deposited on 2012-06-25, released 2012-08-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: monoclonal antibody CR8033 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQL (0-End)
  • Chain 'L':
    Compound: monoclonal antibody CR8033 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQL (0-214)
    Domains in SCOPe 2.03: d4fqll1, d4fqll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fqlL (L:)
    eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygastratgip
    arfsgsgsgtdftltisrlepedlavyycqqygsspwtfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec