PDB entry 4fqh

View 4fqh on RCSB PDB site
Description: Crystal Structure of Fab CR9114
Class: immune system
Keywords: neutralizing antibodies, antibody affinity, antigens, epitope, glycosylation, hemagglutinin glycoproteins, immunoglobulin Fab fragment, influenza virus, influenza vaccines, membrane fusion, IMMUNE SYSTEM
Deposited on 2012-06-25, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody CR9114 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQH (0-End)
  • Chain 'B':
    Compound: Antibody CR9114 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQH
    Domains in SCOPe 2.07: d4fqhb1, d4fqhb2
  • Chain 'H':
    Compound: Antibody CR9114 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQH
  • Chain 'L':
    Compound: Antibody CR9114 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQH
    Domains in SCOPe 2.07: d4fqhl1, d4fqhl2
  • Heterogens: EDO, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fqhB (B:)
    qsaltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvp
    drfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqhB (B:)
    saltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvpd
    rfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fqhL (L:)
    qsaltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvp
    drfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqhL (L:)
    saltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvpd
    rfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt