PDB entry 4fq8

View 4fq8 on RCSB PDB site
Description: Crystal Structure of Shikimate Dehydrogenase (aroE) Y210A Mutant from Helicobacter pylori in Complex with Shikimate
Class: oxidoreductase
Keywords: dehydrogenase, NADP Binding, OXIDOREDUCTASE
Deposited on 2012-06-25, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56119 (0-262)
      • engineered mutation (209)
    Domains in SCOPe 2.05: d4fq8a1, d4fq8a2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56119 (0-262)
      • engineered mutation (209)
    Domains in SCOPe 2.05: d4fq8b1, d4fq8b2
  • Heterogens: SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fq8A (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaagfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fq8A (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaagfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fq8B (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaagfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fq8B (B:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaagfltpflslakelktpfqdgkdmliyqaal
    sfekfsasqipyskafevmrsvf