PDB entry 4fpz

View 4fpz on RCSB PDB site
Description: Crystal structure of Ribosome inactivating protein (RIP) from Momordica balsamina with Uracil at 1.7 Angstrom resolution
Class: hydrolase
Keywords: ribosome inactivation, HYDROLASE
Deposited on 2012-06-24, released 2012-07-11
Made obsolete by 5ilx on 2016-03-23

The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rRNA N-glycosidase
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fpza_
  • Heterogens: NAG, URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fpzA (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni