PDB entry 4fos

View 4fos on RCSB PDB site
Description: Crystal Structure of Shikimate Dehydrogenase (aroE) Q237A Mutant from Helicobacter pylori in Complex with Shikimate
Class: oxidoreductase
Keywords: shikimate, dehydrogenase, NADP Binding, OXIDOREDUCTASE
Deposited on 2012-06-21, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: aroE, HP_1249
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56119 (0-262)
      • engineered mutation (236)
    Domains in SCOPe 2.05: d4fosa1, d4fosa2
  • Heterogens: SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fosA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyaaal
    sfekfsasqipyskafevmrsvflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fosA (A:)
    mklksfgvfgnpikhsksplihnacfltfqkelrflghyhpillpleshikseflhlgls
    ganvtlpfkerafqvcdkikgialecgavntlvlendelvgyntdalgfylslkqknyqn
    alilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdcfmeppksafdliinat
    saslhnelplnkevlkgyfkegklaydlaygfltpflslakelktpfqdgkdmliyaaal
    sfekfsasqipyskafevmrsvf