PDB entry 4fop

View 4fop on RCSB PDB site
Description: Crystal Structure of Peptidyl-tRNA hydrolase from Acinetobacter baumannii at 1.86 A resolution
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2012-06-21, released 2012-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4fopa_
  • Heterogens: GOL, PEG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fopA (A:)
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa