PDB entry 4fo2

View 4fo2 on RCSB PDB site
Description: Heat-labile enterotoxin LT-IIb-B5(T13I) mutant
Class: toxin
Keywords: B pentamer of LT-IIb T13I mutant, TOXIN
Deposited on 2012-06-20, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.225
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2a_
  • Chain 'B':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2b_
  • Chain 'C':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2c_
  • Chain 'D':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2d_
  • Chain 'E':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2e_
  • Chain 'F':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2f_
  • Chain 'G':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2g_
  • Chain 'H':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2h_
  • Chain 'I':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2i_
  • Chain 'J':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2j_
  • Chain 'K':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2k_
  • Chain 'L':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2l_
  • Chain 'M':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2m_
  • Chain 'N':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2n_
  • Chain 'O':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2o_
  • Chain 'P':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2p_
  • Chain 'Q':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2q_
  • Chain 'R':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2r_
  • Chain 'S':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2s_
  • Chain 'T':
    Compound: Heat-labile enterotoxin IIB, B chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43529 (0-97)
      • engineered mutation (12)
    Domains in SCOPe 2.07: d4fo2t_
  • Heterogens: NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2A (A:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2B (B:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2C (C:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2D (D:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2E (E:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2F (F:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2G (G:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2H (H:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2I (I:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2J (J:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2K (K:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2L (L:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2M (M:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2N (N:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2O (O:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2P (P:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2Q (Q:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2R (R:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2S (S:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fo2T (T:)
    gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaielea