PDB entry 4fmj

View 4fmj on RCSB PDB site
Description: Merkel cell polyomavirus VP1 in complex with GD1a oligosaccharide
Class: viral protein
Keywords: viral capsid protein, jelly roll, encapsidation, receptor binding, sialylated oligosaccharides, VIRAL PROTEIN
Deposited on 2012-06-17, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmja_
  • Chain 'B':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjb_
  • Chain 'C':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjc_
  • Chain 'D':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjd_
  • Chain 'E':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmje_
  • Chain 'F':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjf_
  • Chain 'G':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjg_
  • Chain 'H':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjh_
  • Chain 'I':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmji_
  • Chain 'J':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjj_
  • Chain 'K':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjk_
  • Chain 'L':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjl_
  • Chain 'M':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjm_
  • Chain 'N':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjn_
  • Chain 'O':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjo_
  • Chain 'P':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjp_
  • Chain 'Q':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjq_
  • Chain 'R':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjr_
  • Chain 'S':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjs_
  • Chain 'T':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmjt_
  • Heterogens: GOL, CL, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fmjA (A:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjA (A:)
    evlsvvtgedsitqielylnprmgvnspdlptsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa
    iggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypiev
    wcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadiv
    gflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fmjB (B:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjB (B:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fmjC (C:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjC (C:)
    evlsvvtgedsitqielylnprmgvnspdltsnwytytydlqpkgsspdqpikenlpays
    varvslpmlnedtcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakldkd
    gnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglf
    iscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fmjD (D:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjD (D:)
    vevlsvvtgedsitqielylnprmgvnspdlttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fmjE (E:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjE (E:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fmjF (F:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjF (F:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4fmjG (G:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjG (G:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4fmjH (H:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjH (H:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4fmjI (I:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjI (I:)
    vevlsvvtgedsitqielylnprmgvnspdltsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa
    iggepldlqglvldyqtqypkgpitietvlgrkmtpknqgldpqakakldkdgnypievw
    cpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadivg
    flfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4fmjJ (J:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjJ (J:)
    evlsvvtgedsitqielylnprmgvnspdlttsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4fmjK (K:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjK (K:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnedtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fmjL (L:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjL (L:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fmjM (M:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjM (M:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fmjN (N:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjN (N:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fmjO (O:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjO (O:)
    vevlsvvtgedsitqielylnprmgvnspdlttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4fmjP (P:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjP (P:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4fmjQ (Q:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjQ (Q:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4fmjR (R:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjR (R:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsg
    vnyhmfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4fmjS (S:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjS (S:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4fmjT (T:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmjT (T:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk