PDB entry 4fmi

View 4fmi on RCSB PDB site
Description: Merkel cell polyomavirus VP1 in complex with 3'-sialyllactosamine
Class: viral protein
Keywords: viral capsid protein, jelly roll, encapsidation, receptor binding, sialylated oligosaccharides, VIRAL PROTEIN
Deposited on 2012-06-17, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmia_
  • Chain 'B':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmib_
  • Chain 'C':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmic_
  • Chain 'D':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmid_
  • Chain 'E':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmie_
  • Chain 'F':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmif_
  • Chain 'G':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmig_
  • Chain 'H':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmih_
  • Chain 'I':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmii_
  • Chain 'J':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmij_
  • Chain 'K':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmik_
  • Chain 'L':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmil_
  • Chain 'M':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmim_
  • Chain 'N':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmin_
  • Chain 'O':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmio_
  • Chain 'P':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmip_
  • Chain 'Q':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmiq_
  • Chain 'R':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmir_
  • Chain 'S':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmis_
  • Chain 'T':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmit_
  • Heterogens: GOL, CL, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fmiA (A:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiA (A:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fmiB (B:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiB (B:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsg
    vnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakl
    dkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgd
    glfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fmiC (C:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiC (C:)
    vevlsvvtgedsitqielylnprmgvnspdlptsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsg
    vnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakl
    dkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgd
    glfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fmiD (D:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiD (D:)
    vevlsvvtgedsitqielylnprmgvnspdltsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa
    iggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fmiE (E:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiE (E:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fmiF (F:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiF (F:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4fmiG (G:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiG (G:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlneddtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgn
    ypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfis
    cadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4fmiH (H:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiH (H:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4fmiI (I:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiI (I:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypkgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4fmiJ (J:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiJ (J:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4fmiK (K:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiK (K:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnecdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvn
    yhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgn
    ypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfis
    cadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fmiL (L:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiL (L:)
    gvevlsvvtgedsitqielylnprmgvnspdlttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fmiM (M:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiM (M:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fmiN (N:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiN (N:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fmiO (O:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiO (O:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4fmiP (P:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiP (P:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlnedtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4fmiQ (Q:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiQ (Q:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4fmiR (R:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiR (R:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4fmiS (S:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiS (S:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4fmiT (T:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmiT (T:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlncdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypkttpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk