SCOPe 2.03: Structural Classification of Proteins

PDB entry 4fmh

View 4fmh on RCSB PDB site
Description: Merkel Cell Polyomavirus VP1 in complex with Disialyllactose
Class: viral protein
Keywords: viral capsid protein, jelly roll, encapsidation, receptor binding, sialylated oligosaccharides, VIRAL PROTEIN
Deposited on 2012-06-17, released 2012-09-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmha_
Chain 'B':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhb_
Chain 'C':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhc_
Chain 'D':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmhd_
Chain 'E':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmhe_
Chain 'F':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhf_
Chain 'G':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhg_
Chain 'H':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhh_
Chain 'I':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhi_
Chain 'J':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhj_
Chain 'K':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhk_
Chain 'L':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhl_
Chain 'M':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmhm_
Chain 'N':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmhn_
Chain 'O':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmho_
Chain 'P':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhp_
Chain 'Q':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhq_
Chain 'R':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1 (Start-288)
Domains in SCOPe 2.03: d4fmhr_
Chain 'S':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmhs_
Chain 'T':
Compound: vp1
Species: Merkel cell polyomavirus [TaxId:493803]
Gene: VP1
Database cross-references and differences (RAF-indexed):
- Uniprot C0JPK1
Domains in SCOPe 2.03: d4fmht_
Heterogens: GOL, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4fmhA (A:)
gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn