PDB entry 4fmh

View 4fmh on RCSB PDB site
Description: Merkel Cell Polyomavirus VP1 in complex with Disialyllactose
Class: viral protein
Keywords: viral capsid protein, jelly roll, encapsidation, receptor binding, sialylated oligosaccharides, VIRAL PROTEIN
Deposited on 2012-06-17, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.166
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmha_
  • Chain 'B':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhb_
  • Chain 'C':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhc_
  • Chain 'D':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhd_
  • Chain 'E':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhe_
  • Chain 'F':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhf_
  • Chain 'G':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhg_
  • Chain 'H':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhh_
  • Chain 'I':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhi_
  • Chain 'J':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhj_
  • Chain 'K':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhk_
  • Chain 'L':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhl_
  • Chain 'M':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhm_
  • Chain 'N':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhn_
  • Chain 'O':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmho_
  • Chain 'P':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhp_
  • Chain 'Q':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhq_
  • Chain 'R':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhr_
  • Chain 'S':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmhs_
  • Chain 'T':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fmht_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fmhA (A:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhA (A:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnedtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgn
    ypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfis
    cadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fmhB (B:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhB (B:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fmhC (C:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhC (C:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fmhD (D:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhD (D:)
    vevlsvvtgedsitqielylnprmgvnspdltsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fmhE (E:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhE (E:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnedcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgv
    nyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdg
    nypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfi
    scadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fmhF (F:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhF (F:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4fmhG (G:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhG (G:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4fmhH (H:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhH (H:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak
    ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg
    dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4fmhI (I:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhI (I:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4fmhJ (J:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhJ (J:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4fmhK (K:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhK (K:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneddtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvn
    yhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgn
    ypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfis
    cadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fmhL (L:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhL (L:)
    gvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenl
    paysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fmhM (M:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhM (M:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fmhN (N:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhN (N:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fmhO (O:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhO (O:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4fmhP (P:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhP (P:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneddtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvn
    yhmfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdg
    nypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfi
    scadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4fmhQ (Q:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhQ (Q:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4fmhR (R:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhR (R:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs
    gvnyhmfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4fmhS (S:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhS (S:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4fmhT (T:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmhT (T:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk