PDB entry 4fmg

View 4fmg on RCSB PDB site
Description: Merkel Cell Polyomavirus VP1 Unassembled Pentamer
Class: viral protein
Keywords: viral capsid protein, jelly roll, encapsidation, receptor binding, sialylated oligosaccharides, VIRAL PROTEIN
Deposited on 2012-06-17, released 2012-09-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmga_
  • Chain 'B':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgb_
  • Chain 'C':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgc_
  • Chain 'D':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgd_
  • Chain 'E':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmge_
  • Chain 'F':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgf_
  • Chain 'G':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgg_
  • Chain 'H':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgh_
  • Chain 'I':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgi_
  • Chain 'J':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgj_
  • Chain 'K':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgk_
  • Chain 'L':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgl_
  • Chain 'M':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgm_
  • Chain 'N':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgn_
  • Chain 'O':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgo_
  • Chain 'P':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgp_
  • Chain 'Q':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgq_
  • Chain 'R':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgr_
  • Chain 'S':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgs_
  • Chain 'T':
    Compound: vp1
    Species: Merkel cell polyomavirus [TaxId:493803]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fmgt_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fmgA (A:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgA (A:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fmgB (B:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgB (B:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fmgC (C:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgC (C:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlncdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvny
    hmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakldkd
    gnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglf
    iscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fmgD (D:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgD (D:)
    vevlsvvtgedsitqielylnprmgvnspdltsnwytytydlqpkgsspdqpikenlpay
    svarvslpmlncdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fmgE (E:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgE (E:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fmgF (F:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgF (F:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4fmgG (G:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgG (G:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4fmgH (H:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgH (H:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnecdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvn
    yhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakakldk
    dgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdgl
    fiscadivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4fmgI (I:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgI (I:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4fmgJ (J:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgJ (J:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4fmgK (K:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgK (K:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnetlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnyp
    ievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisca
    divgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fmgL (L:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgL (L:)
    vevlsvvtgedsitqielylnprmgvnspdlttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fmgM (M:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgM (M:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlnlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmfa
    iggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypiev
    wcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadiv
    gflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fmgN (N:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgN (N:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fmgO (O:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgO (O:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4fmgP (P:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgP (P:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnetlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh
    mfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgny
    pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc
    adivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4fmgQ (Q:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgQ (Q:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4fmgR (R:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgR (R:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlnlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhmf
    aiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4fmgS (S:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgS (S:)
    vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp
    aysvarvslpmlntlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktgpitietvlgrkmtpknqgldpqakakldkdgnypi
    evwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscad
    ivgflfktsgkmalhglpryfnvtlrkrwvk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4fmgT (T:)
    gshmleggvevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspd
    qpikenlpaysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhd
    ygagipvsgvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqg
    ldpqakakldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvllden
    gvgplckgdglfiscadivgflfktsgkmalhglpryfnvtlrkrwvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fmgT (T:)
    evlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlpa
    ysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyhm
    faiggepldlqglvldyqtqypktpitietvlgrkmtpknqgldpqakakldkdgnypie
    vwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfiscadi
    vgflfktsgkmalhglpryfnvtlrkrwvk