PDB entry 4fm4

View 4fm4 on RCSB PDB site
Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1
Class: lyase
Keywords: iron type hydratase, Hydrolysis, sulfinic acid, LYASE
Deposited on 2012-06-15, released 2012-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'B':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'C':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'D':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'E':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'F':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'G':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'H':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'I':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'J':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
  Domains in SCOPe 2.02: d4fm4j_
• Chain 'K':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'L':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'M':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
• Chain 'N':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Chain 'O':
  Compound: Nitrile hydratase alpha subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (Start-208)
  Domains in SCOPe 2.02: d4fm4o_
• Chain 'P':
  Compound: Nitrile hydratase beta subunit
  Species: Comamonas testosteroni [TaxId:285]
  Database cross-references and differences (RAF-indexed):
  • PDB 4FM4 (0-205)
• Heterogens: PO4, FE, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fm4J (J:)
  mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
  rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk
  lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
  kdlwpdgceaadvhvgvfqsyllsae
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  Sequence, based on SEQRES records: (download)
  

  >4fm4O (O:)
  memtdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvf
  kaqllsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwyk
  eleyrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlat
  litqdcligvsrleapfaalpapavalga
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4fm4O (O:)
  tdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvfkaq
  llsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwykele
  yrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlatlit
  qdcligvsrleapfaalpapavalga
  

  
  
• Chain 'P':
  No sequence available.