PDB entry 4fm4

View 4fm4 on RCSB PDB site
Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1
Class: lyase
Keywords: iron type hydratase, Hydrolysis, sulfinic acid, LYASE
Deposited on 2012-06-15, released 2012-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'C':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'D':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'E':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'F':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'G':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'H':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'I':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'J':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
    Domains in SCOPe 2.02: d4fm4j_
  • Chain 'K':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'L':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'M':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
  • Chain 'N':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Chain 'O':
    Compound: Nitrile hydratase alpha subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (Start-208)
    Domains in SCOPe 2.02: d4fm4o_
  • Chain 'P':
    Compound: Nitrile hydratase beta subunit
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FM4 (0-205)
  • Heterogens: PO4, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fm4J (J:)
    mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
    rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk
    lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
    kdlwpdgceaadvhvgvfqsyllsae
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fm4O (O:)
    memtdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvf
    kaqllsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwyk
    eleyrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlat
    litqdcligvsrleapfaalpapavalga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fm4O (O:)
    tdnavmeqrvdalfvltkelglvtdqtvpdyedalmhdwlpqngaklvakawtdpvfkaq
    llsegvaaseslgfsfpkhhkhfvvlentpelhnviccslcsctaftiigmapdwykele
    yrarivrqartvlkeigldlpesidirvwdttadtrymvlplrpqgtedwseaqlatlit
    qdcligvsrleapfaalpapavalga
    

  • Chain 'P':
    No sequence available.