PDB entry 4fls

View 4fls on RCSB PDB site
Description: Crystal structure of Amylosucrase inactive double mutant F290K-E328Q from Neisseria polysaccharea in complex with sucrose.
Class: transferase
Keywords: beta/alpha-barrel, glycoside hydrolase, amylose synthesis, sucrose isomerization, glucosyltransferase carbohydrate, transferase
Deposited on 2012-06-15, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Gene: ams
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (4-627)
      • expression tag (0-3)
      • engineered mutation (289)
      • engineered mutation (327)
      • cloning artifact (536)
    Domains in SCOPe 2.06: d4flsa1, d4flsa2, d4flsa3
  • Heterogens: SUC, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4flsA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavakiwkqmgtsce
    nlpqahalirafnavmriaapavffksqaivhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia