PDB entry 4flp

View 4flp on RCSB PDB site
Description: Crystal Structure of the first bromodomain of human BRDT in complex with the inhibitor JQ1
Class: transcription regulator/inhibitor
Keywords: BRDT, bromodomain containing protein testis specific, Nucleus, Transcription, Transcription regulation, Structural Genomics Consortium, SGC, Bromodomain, TRANSCRIPTION REGULATOR-INHIBITOR complex
Deposited on 2012-06-15, released 2012-07-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.213
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4flpa_
  • Chain 'B':
    Compound: Bromodomain testis-specific protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRDT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4flpb_
  • Heterogens: JQ1, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4flpA (A:)
    smntkkngrltnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlnt
    ikkrlenkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4flpA (A:)
    tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
    akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4flpB (B:)
    smntkkngrltnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlnt
    ikkrlenkyyakaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4flpB (B:)
    tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
    akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpq