PDB entry 4fl1

View 4fl1 on RCSB PDB site
Description: Structural and Biophysical Characterization of the Syk Activation Switch
Class: transferase
Keywords: Transferase, Protein Kinase
Deposited on 2012-06-14, released 2012-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fl1a_
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fl1A (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fl1A (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyy
    kfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnl
    cwtydvenrpgfaavelrlrnyyydvvn