PDB entry 4fkd

View 4fkd on RCSB PDB site
Description: Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta
Class: transferase
Keywords: PKC theta, second cysteine rich regulatory domain, activator binding site, zinc finger, Kinase, TRANSFERASE
Deposited on 2012-06-13, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.173
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C theta type
    Species: Mus musculus [TaxId:10090]
    Gene: Prkcq, Pkcq
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02111 (9-58)
      • expression tag (0-8)
      • expression tag (59-64)
    Domains in SCOPe 2.06: d4fkda1, d4fkda2, d4fkda3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fkdA (A:)
    gsrrasvgshrfkvynyksptfcehcgtllwglarqglkcdacgmnvhhrcqtkvanlce
    fivtd