PDB entry 4fk6

View 4fk6 on RCSB PDB site
Description: JAK1 kinase (JH1 domain) in complex with compound 72
Class: transferase/transferase inhibitor
Keywords: protein kinase, phospho transfer, phospho tyrosine, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-06-12, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fk6a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fk6b_
  • Heterogens: 0UJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fk6A (A:)
    gdivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkp
    esggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknk
    nkinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdk
    eyytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmi
    gpthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeal
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fk6A (A:)
    tevdpthfekrflkrirdlgefgkvelcrydpegdntgeqvavkslkpenhiadlkkeie
    ilrnlyhenivkykgictedggngiklimeflpsgslkeylpknknkinlkqqlkyavqi
    ckgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfw
    yapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvnt
    lkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fk6B (B:)
    gdivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkp
    esggnhiadlkkeieilrnlyhenivkykgictedggngiklimeflpsgslkeylpknk
    nkinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdk
    eyytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmi
    gpthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeal
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fk6B (B:)
    evdpthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpenhiadlkkei
    eilrnlyhenivkykgictegngiklimeflpsgslkeylpknknkinlkqqlkyavqic
    kgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwy
    apeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntl
    kegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk