PDB entry 4fk5

View 4fk5 on RCSB PDB site
Description: Structure of the SAGA Ubp8(S144N)/Sgf11/Sus1/Sgf73 DUB module
Class: hydrolase
Keywords: Multi-protein complex, Deubiquitination, Transcription, Nucleosome, HYDROLASE
Deposited on 2012-06-12, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin carboxyl-terminal hydrolase 8
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: UBP8, YM9959.05, YMR223W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50102 (5-475)
    • expression tag (3-4)
    • engineered mutation (148)
• Chain 'B':
  Compound: Protein SUS1
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: SUS1, YBR111W-A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6WNK7 (Start-95)
  Domains in SCOPe 2.08: d4fk5b_
• Chain 'C':
  Compound: SAGA-associated factor 11
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: SGF11, YPL047W
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03067
• Chain 'E':
  Compound: SAGA-associated factor 73
  Species: Saccharomyces cerevisiae [TaxId:559292]
  Gene: SGF73, YGL066W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53165
• Heterogens: ZN, GOL, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4fk5B (B:)
  mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
  ilstvepkalemvsdstretvlkqirefleeivdtq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4fk5B (B:)
  taqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilst
  vepkalemvsdstretvlkqirefleeivdtq
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.