PDB entry 4fjz

View 4fjz on RCSB PDB site
Description: Crystal structure of PI3K-gamma in complex with pyrrolo-pyridine inhibitor 63
Class: Transferase/Inhibitor
Keywords: inflammation, cancer, p110, C2 domain, leukocytes, kinase, p85, phosphotransferase, Transferase-Inhibitor complex
Deposited on 2012-06-12, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fjza1, d4fjza2, d4fjza3, d4fjza4
  • Heterogens: SO4, 4FJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fjzA (A:)
    gseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjzA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihrsttsqtikvspddtpgailqsfdfvlrvcgrdeylvgetp
    iknfqwvrhclkngeeihvvldtppdpaldevrkedcdrkfrvkirgidipvldltvfve
    aniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkvqllyyv
    nlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldnialpkaemp
    nqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivakty
    qllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavk
    fepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtam
    lhdftqqvqviemlqkvtldikslsadvssqvisqlkqklenlqnsqlpesfrvpydpgl
    kagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrim
    esiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgafkdevlnhwlkek
    spteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghkervpfv
    ltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqltske
    dieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl