PDB entry 4fj1

View 4fj1 on RCSB PDB site
Description: Crystal Structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (Holo form) and genistein
Class: oxidoreductase/Oxidoreductase inhibitor
Keywords: Short chain Dehydrogenase/Reductase, Rossmann Fold, Oxidoreductase, NADP(H), oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2012-06-11, released 2013-07-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.161
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fj1a_
  • Chain 'B':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fj1b_
  • Chain 'C':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fj1c_
  • Chain 'D':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Cochliobolus lunatus [TaxId:5503]
    Gene: 17HSDcl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fj1d_
  • Heterogens: NAP, DMS, GEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fj1A (A:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fj1A (A:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fj1B (B:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fj1B (B:)
    ipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsdai
    aikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrgq
    ffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkkit
    vnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgflv
    skegewvngkvltldggaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fj1C (C:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fj1C (C:)
    pgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsdaia
    ikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntrgqf
    fvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkkitv
    navapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgflvs
    kegewvngkvltldggaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fj1D (D:)
    mphvenasetyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvv
    seikalgsdaiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeef
    drvfslntrgqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvri
    fskdcgdkkitvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwp
    qdvanvvgflvskegewvngkvltldggaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fj1D (D:)
    tyipgrldgkvalvtgsgrgigaavavhlgrlgakvvvnyanstkdaekvvseikalgsd
    aiaikadirqvpeivklfdqavahfghldiavsnsgvvsfghlkdvteeefdrvfslntr
    gqffvareayrhlteggrivltssntskdfsvpkhslysgskgavdsfvrifskdcgdkk
    itvnavapggtvtdmfhevshhyipngtsytaeqrqqmaahasplhrngwpqdvanvvgf
    lvskegewvngkvltldggaa