PDB entry 4fiv

View 4fiv on RCSB PDB site
Description: fiv protease complexed with an inhibitor lp-130
Deposited on 1998-07-15, released 1999-01-13
The last revision prior to the SCOP 1.57 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d4fiv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fiv_ (-)
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm