PDB entry 4fip

View 4fip on RCSB PDB site
Description: Structure of the SAGA Ubp8(S144N)/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module
Class: hydrolase
Keywords: Domain-swapping, Deubiquitination, Transcription, Nucleosomes, HYDROLASE
Deposited on 2012-06-10, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.187
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: UBP8, YM9959.05, YMR223W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50102 (5-475)
      • expression tag (4)
      • engineered mutation (148)
  • Chain 'B':
    Compound: Protein SUS1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SUS1, YBR111W-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fipb_
  • Chain 'C':
    Compound: SAGA-associated factor 11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF11, YPL047W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: SAGA-associated factor 73
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF73, YGL066W
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ubiquitin carboxyl-terminal hydrolase 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: UBP8, YM9959.05, YMR223W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50102 (5-475)
      • engineered mutation (148)
  • Chain 'F':
    Compound: Protein SUS1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SUS1, YBR111W-A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fipf_
  • Chain 'G':
    Compound: SAGA-associated factor 11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF11, YPL047W
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: SAGA-associated factor 73
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF73, YGL066W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fipB (B:)
    mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
    ilstvepkalemvsdstretvlkqirefleeivdtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fipB (B:)
    aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
    epkalemvsdstretvlkqirefleeivdt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fipF (F:)
    mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
    ilstvepkalemvsdstretvlkqirefleeivdtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fipF (F:)
    aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
    epkalemvsdstretvlkqirefleeivdt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.