PDB entry 4fip
View 4fip on RCSB PDB site
Description: Structure of the SAGA Ubp8(S144N)/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module
Class: hydrolase
Keywords: Domain-swapping, Deubiquitination, Transcription, Nucleosomes, HYDROLASE
Deposited on
2012-06-10, released
2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-08-29, with a file datestamp of
2012-08-24.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.187
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ubiquitin carboxyl-terminal hydrolase 8
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: UBP8, YM9959.05, YMR223W
Database cross-references and differences (RAF-indexed):
- Uniprot P50102 (5-475)
- expression tag (4)
- engineered mutation (148)
- Chain 'B':
Compound: Protein SUS1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SUS1, YBR111W-A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4fipb_ - Chain 'C':
Compound: SAGA-associated factor 11
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SGF11, YPL047W
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: SAGA-associated factor 73
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SGF73, YGL066W
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Ubiquitin carboxyl-terminal hydrolase 8
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: UBP8, YM9959.05, YMR223W
Database cross-references and differences (RAF-indexed):
- Uniprot P50102 (5-475)
- engineered mutation (148)
- Chain 'F':
Compound: Protein SUS1
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SUS1, YBR111W-A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4fipf_ - Chain 'G':
Compound: SAGA-associated factor 11
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SGF11, YPL047W
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: SAGA-associated factor 73
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SGF73, YGL066W
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4fipB (B:)
mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
ilstvepkalemvsdstretvlkqirefleeivdtq
Sequence, based on observed residues (ATOM records): (download)
>4fipB (B:)
aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
epkalemvsdstretvlkqirefleeivdt
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
Sequence, based on SEQRES records: (download)
>4fipF (F:)
mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
ilstvepkalemvsdstretvlkqirefleeivdtq
Sequence, based on observed residues (ATOM records): (download)
>4fipF (F:)
aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
epkalemvsdstretvlkqirefleeivdt
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.