PDB entry 4fhr

View 4fhr on RCSB PDB site
Description: Crystal structure of the complex between the flagellar motor proteins FliG and FliM.
Class: motor protein
Keywords: flagellar motor, MOTOR PROTEIN
Deposited on 2012-06-06, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar motor switch protein fliM
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FliM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZE6 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: Flagellar motor switch protein fliG
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FLIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY63 (3-215)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4fhrb1, d4fhrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fhrB (B:)
    ghmdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspe
    vvkeiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpeladei
    rrrmfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkde
    leymgpvrlkdveeaqqkiiniirrleeageiviar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fhrB (B:)
    hmdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspev
    vkeiernlekkisgfvggidtaaeimnnldrttekkimdklvqenpeladeirrrmfvfe
    dilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeleymgpvr
    lkdveeaqqkiiniirrleeageiviar