PDB entry 4fh6

View 4fh6 on RCSB PDB site
Description: Structure of DHP A in complex with 2,4,6-tribromophenol in 10% DMSO
Class: oxidoreductase
Keywords: peroxidase, globin, oxidoreductase
Deposited on 2012-06-05, released 2013-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.205
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fh6a_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4fh6b_
  • Heterogens: HEM, SO4, TBP, OXY, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fh6A (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fh6B (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk