PDB entry 4fh1

View 4fh1 on RCSB PDB site
Description: S. cerevisiae Ubc13-N79A
Class: ligase
Keywords: Ubiquitin Conjugating Enzyme, LIGASE
Deposited on 2012-06-05, released 2013-01-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 13
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: UBC13, YDR092W, YD6652.04
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52490
      • engineered mutation (78)
      • engineered mutation (86)
    Domains in SCOPe 2.03: d4fh1a_
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fh1A (A:)
    maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
    dypmeapkvrfltkiyhpaidrlgrisldvlktnwspalqirtvllsiqallaspnpndp
    landvaedwikneqgakakarewtklyakkkpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fh1A (A:)
    slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
    pmeapkvrfltkiyhpaidrlgrisldvlktnwspalqirtvllsiqallaspnpnndva
    edwikneqgakakarewtklyakkk